IGF-1 LR3 1mg

  * Marked fields are required.
Qty*
Price $69.98
Availability In-Stock

 This product is for research only and not for human consumption.

 

  • CAS: 946870-92-4
  • Formula: C990H1528N262O300S7
  • Molecular weight: 9200
  • Peptide purity: > 99.0%
  • Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
 

 IGF1-LR3 is also known as Long R3 IGF-1.  It is a growth factor similar to insulin, a variant of insulin group peptide hormones that has been modified.   The molecular formula is C990H1528N262O300S7, and the weight is 9.200. 

 The included variations on this peptide are an additional 13 amino acids and one substitution that causes this version to be both stable and effective.  It also boasts a longer half-life and repels the binding of other proteins.

 IGF1-LR3 was created purposely for use in researching cultured cells.  Currently, few researchers have actually confirmed the claim of stronger properties than original IGF, or that is promotes more dense muscle tissue cause by hyperplasia of cells.  

 This is a research compound that is released in response to the G-hormone, and it stimulates cell functioning.  In addition, it causes cells to be more sensitive to insulin.  Studies may suggest these modifications in the structure encourage the transportation of glucose and amino acids to cells, and stimulate protein generation.